HORDB

ID: hor006273
Uniprot ID: Q27913
Protein name: Growth-blocking peptide
Gene name: NA
Organism: Mythimna separata (Oriental armyworm) (Pseudaletia separata)
Family: GBP/PSP1/paralytic peptide family
Source: animal
Expression: By parasitization and low temperatures. |Levels are highest on day 0 of penultimate instar larvae and then decrease throughout larval growth with a temporary increase on day 0 of the last larval instar. In parasitized larvae, expression increases within o
Disease: NA
Comments: NA
Taxonomy: Mythimna (genus), Hadeninae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera , Ditrysia , Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005125 cytokine activity; GO:0008083 growth factor activity
GO BP: GO:0007165 signal transduction; GO:0032225 regulation of synaptic transmission, dopaminergic; GO:0035099 hemocyte migration; GO:0051781 positive regulation of cell division
GO CC: GO:0005575 cellular_component; GO:0005615 extracellular space

Sequence: ENFSGGCVAGYMRTPDGRCKPTF
Length: 23
Propeptide: MKLTISILFCVILTLQYNGADGKLKDLFGKIHDSVHGTADKVKEDLNSLFHPNDKNQQGNNDASSNIHFADSEENTDAAKKPDEVTPATTTTTTAAPAVPNAPSDNPTTLAPSTTTKDGRENFSGGCVAGYMRTPDGRCKPTFYQ
Signal peptide: MKLTISILFCVILTLQYNGADG
Modification: NA
Glycosylation: NA
Mutagenesis: 1-1Missing: Abolishes plasmatocyte spreading activity.; 5-5Missing: Abolishes plasmatocyte spreading activity.; 5-5Missing: Abolishes plasmatocyte spreading activity.; 6-6Missing: Abolishes plasmatocyte spreading activity.; 6-6Missing: Abolishes plasmatoc

Function: Biogenic peptide that prevents the onset of metamorphosis from larva to pupa. Has repressive activity against juvenile hormone esterase. Induces cell proliferation at low concentrations and inhibits it at high concentrations. Mediates the spreading of plasmatocytes to foreign surfaces. May have a role in the regulation of dopamine concentrations.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006273_AF2.pdb

hor006273_ESM.pdb

Mass:	288639	Formula:	C106H161N31O33S3
Absent amino acids:	HILQW	Common amino acids:	G
pI:	8.22	Basic residues:	3
Polar residues:	11	Hydrophobic residues:	4
Hydrophobicity:	-57.39	Boman Index:	-4576
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	16.96
Instability Index:	1606.09	Extinction Coefficient cystines:	1615
Absorbance 280nm:	73.41

PubMed ID: 7498538
Title: Molecular cloning and characterization of cDNA for insect biogenic peptide, growth-blocking peptide.
PubMed ID: 9654083
Title: Growth-blocking peptide expressed in the insect nervous system--cloning and functional characterization.
PubMed ID: 2022627
Title: Structure of a growth-blocking peptide present in parasitized insect hemolymph.
PubMed ID: 12182821
Title: Expression and purification of a small cytokine growth-blocking peptide from armyworm Pseudaletia separata by an optimized fermentation method using the methylotrophic yeast Pichia pastoris.
PubMed ID: 8580912
Title: Growth-blocking peptide titer during larval development of parasitized and cold-stressed armyworm.
PubMed ID: 9753606
Title: Cell growth activity of growth-blocking peptide.
PubMed ID: 10928276
Title: Distribution of growth-blocking peptide in the insect central nervous tissue.
PubMed ID: 11429413
Title: Structure and activity of the insect cytokine growth-blocking peptide. Essential regions for mitogenic and hemocyte-stimulating activities are separate.
PubMed ID: 15385535
Title: The Gly-Gly linker region of the insect cytokine growth-blocking peptide is essential for activity.
PubMed ID: 9890941
Title: Solution structure of an insect growth factor, growth-blocking peptide.